PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 322aa    MW: 35278.4 Da    PI: 8.4692
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-6550PU_refplantGDBView CDS
gnl|UG|Vun#S45936205PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++++k++G g+W++ ++  g+ R++k+c++rw +yl
        Vun002092 14 KGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding58.51.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++
        Vun002092  67 RGNFTEDEDELIINLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.02961IPR017930Myb domain
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
SuperFamilySSF466891.62E-2913108IPR009057Homeodomain-like
PfamPF002495.6E-161461IPR001005SANT/Myb domain
CDDcd001677.16E-121661No hitNo description
PROSITE profilePS5129428.81162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2865116IPR009057Homeodomain-like
SMARTSM007179.3E-1866114IPR001005SANT/Myb domain
PfamPF002496.2E-1767111IPR001005SANT/Myb domain
CDDcd001672.83E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDERLINYIK LHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEDEDELIIN LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLYSRG  120
IDPQTHRPLN AASATSATAA VSPPSPAAVP VATSSSSKKI NSDSISSSNT LAHDVVITNN  180
NNINNNNSNG FQLVGNSGYA NATTKVGTDE DSNSSSGVTV EESLPHHQLN LDLSIGLPSP  240
QQVSSSVNPE KLKAQEHDQK PHVLYKWYGN ITGQGVCLCY SLGLQSDQAC YCKGMGATAT  300
ATTVTTTSAD SNLYRFYRPM NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137818.10.0hypothetical protein PHAVU_009G158200g
SwissprotQ388512e-89MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0L9UEB00.0A0A0L9UEB0_PHAAN; Uncharacterized protein
STRINGGLYMA04G38240.11e-151(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-85myb domain protein 7